PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.010G032600.1
Common NamePHAVU_010G032600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family FAR1
Protein Properties Length: 227aa    MW: 25965.6 Da    PI: 8.137
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.010G032600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR181.41.6e-2570159190
                FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         +fY+eYA++ GF vr ++ ++s+ +++i++r+f C+k+g++ + ++kt+  +++r++ r gC+a++ vk +k gkw+vtk+++eH+H l+
  Phvul.010G032600.1  70 NFYDEYARQEGFVVRLDRCHRSEVDNRIISRRFSCNKQGFHVRVRNKTKPVHKPRTSIREGCEAMMLVKVNKCGKWVVTKFVKEHSHLLN 159
                         6*******************************************9999***************************************885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.1E-2270159IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
HTPSLLNFLT LSSTNLTLLA HNPVLISMDL EAVAETVENC TDKISAAFEG SSIVEPNVGM  60
EFDSEEAAKN FYDEYARQEG FVVRLDRCHR SEVDNRIISR RFSCNKQGFH VRVRNKTKPV  120
HKPRTSIREG CEAMMLVKVN KCGKWVVTKF VKEHSHLLNA SGSPSYSKMI ESKDRIIQQL  180
TKELEYRDRL CQQYRRQLFS LLETVEEQTE SLSKNVELVV NNIKNL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007134265.11e-169hypothetical protein PHAVU_010G032600g, partial
TrEMBLV7AL661e-169V7AL66_PHAVU; Uncharacterized protein (Fragment)
STRINGGLYMA03G22670.21e-118(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96531104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.17e-56FAR1 family protein